Web Analysis for Pregnancymiraclereviewlisaolson - pregnancymiraclereviewlisaolson.com
pregnancymiraclereviewlisaolson.com is 1 decade 1 week old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pregnancymiraclereviewlisaolson.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 6 | H2 Headings: | 1 |
H3 Headings: | 3 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 8 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.195.124.215)
Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c
Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti
Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c
Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti
Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c
Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti
HTTP Header Analysis
Date: Tue, 06 May 2014 11:33:12 GMT
Server: Apache
X-Pingback: http://www.pregnancymiraclereviewlisaolson.com/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 16024
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.bluehost.com | 162.159.24.80 | United States of America | |
ns2.bluehost.com | 162.159.25.175 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
pregnancymiraclereviewlisaolson.com | A | 14399 |
IP: 69.195.124.215 |
pregnancymiraclereviewlisaolson.com | NS | 21599 |
Target: ns2.bluehost.com |
pregnancymiraclereviewlisaolson.com | NS | 21599 |
Target: ns1.bluehost.com |
pregnancymiraclereviewlisaolson.com | SOA | 21599 |
MNAME: ns1.bluehost.com RNAME: root.box1015.bluehost.com Serial: 2014050208 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 300 |
pregnancymiraclereviewlisaolson.com | MX | 14399 |
Target: mail.pregnancymiraclereviewlisaolson.com |
pregnancymiraclereviewlisaolson.com | TXT | 14399 |
TXT: v=spf1 a mx ptr include:bluehost.com ?all |
Full WHOIS Lookup
Registry Domain ID: 1857066748_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.bluehost.com
Registrar URL: http://www.bluehost.com/
Updated Date: 2014-05-02T17:43:17Z
Creation Date: 2014-05-02T17:43:17Z
Registrar Registration Expiration Date: 2015-05-02T17:43:17Z
Registrar: FastDomain Inc.
Registrar IANA ID: 1154
Registrar Abuse Contact Email: support@bluehost.com
Registrar Abuse Contact Phone: +1 801 765 9400
Reseller: BlueHost.Com
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: ABULAZEEZ AJIS
Registrant Organization: INTERNET MARKETER
Registrant Street: GULEIL STREET NO 45
Registrant City: JEDDAH
Registrant State/Province:
Registrant Postal Code: -
Registrant Country: SAUDI ARABIA
Registrant Phone: +966.554654552
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: KIITECH@YAHOO.CO.UK
Registry Admin ID:
Admin Name: ABULAZEEZ AJIS
Admin Organization: INTERNET MARKETER
Admin Street: GULEIL STREET NO 45
Admin City: JEDDAH
Admin State/Province:
Admin Postal Code: -
Admin Country: SAUDI ARABIA
Admin Phone: +966.554654552
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: KIITECH@YAHOO.CO.UK
Registry Tech ID:
Tech Name: BLUEHOST INC
Tech Organization: BLUEHOST.COM
Tech Street: 1958 SOUTH 950 EAST
Tech City: PROVO
Tech State/Province: UTAH
Tech Postal Code: 84606
Tech Country: UNITED STATES
Tech Phone: +1.8017659400
Tech Phone Ext:
Tech Fax: +1.8017651992
Tech Fax Ext:
Tech Email: WHOIS@BLUEHOST.COM
Name Server: NS1.BLUEHOST.COM
Name Server: NS2.BLUEHOST.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2014-05-02T17:43:17Z
The data in the BlueHost.Com WHOIS database is provided
to you by BlueHost.Com for information purposes only,
that is, to assist you in obtaining information about or related to
a domain name registration record. BlueHost.Com makes
this information available "as is," and does not guarantee its
accuracy. By submitting a WHOIS query, you agree that you will use
this data only for lawful purposes and that, under no circumstances
will you use this data to: (1) allow, enable, or otherwise support
the transmission of mass unsolicited, commercial advertising or
solicitations via direct mail, electronic mail, or by telephone; or
(2) enable high volume, automated, electronic processes that apply
to BlueHost.Com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of
BlueHost.Com. BlueHost.Com reserves the
right to modify these terms at any time. By submitting this query,
you agree to abide by these terms.
UNLIMITED storage, bandwidth and domains on one account. Also receive a *FREE* domain for one year when you host with http://www.bluehost.com/