1.67 Rating by CuteStat

pregnancymiraclereviewlisaolson.com is 1 decade 1 week old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, pregnancymiraclereviewlisaolson.com is SAFE to browse.

PageSpeed Score
82
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

69.195.124.215

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 6 H2 Headings: 1
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 8
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.195.124.215)

Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c

- mygmss.org

Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti

Not Applicable $ 8.95

My great WordPress blog | Just another WordPress site

- webflipguide.com
Not Applicable $ 8.95

Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c

- susan-hansen.com

Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti

Not Applicable $ 8.95

Strategic support services - Home

- strategicsupportservices.org
Not Applicable $ 8.95

Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c

- reflexkuwait.com

Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 06 May 2014 11:33:12 GMT
Server: Apache
X-Pingback: http://www.pregnancymiraclereviewlisaolson.com/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 16024
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: FastDomain Inc.
Registration Date: May 2, 2014, 12:00 AM 1 decade 1 week 1 day ago
Last Modified: May 2, 2014, 12:00 AM 1 decade 1 week 1 day ago
Expiration Date: May 2, 2015, 12:00 AM 9 years 1 week 16 hours ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.bluehost.com 162.159.24.80 United States of America United States of America
ns2.bluehost.com 162.159.25.175 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
pregnancymiraclereviewlisaolson.com A 14399 IP: 69.195.124.215
pregnancymiraclereviewlisaolson.com NS 21599 Target: ns2.bluehost.com
pregnancymiraclereviewlisaolson.com NS 21599 Target: ns1.bluehost.com
pregnancymiraclereviewlisaolson.com SOA 21599 MNAME: ns1.bluehost.com
RNAME: root.box1015.bluehost.com
Serial: 2014050208
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 300
pregnancymiraclereviewlisaolson.com MX 14399 Target: mail.pregnancymiraclereviewlisaolson.com
pregnancymiraclereviewlisaolson.com TXT 14399 TXT: v=spf1 a mx ptr include:bluehost.com
?all

Full WHOIS Lookup

Domain Name: PREGNANCYMIRACLEREVIEWLISAOLSON.COM
Registry Domain ID: 1857066748_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.bluehost.com
Registrar URL: http://www.bluehost.com/
Updated Date: 2014-05-02T17:43:17Z
Creation Date: 2014-05-02T17:43:17Z
Registrar Registration Expiration Date: 2015-05-02T17:43:17Z
Registrar: FastDomain Inc.
Registrar IANA ID: 1154
Registrar Abuse Contact Email: support@bluehost.com
Registrar Abuse Contact Phone: +1 801 765 9400
Reseller: BlueHost.Com
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: ABULAZEEZ AJIS
Registrant Organization: INTERNET MARKETER
Registrant Street: GULEIL STREET NO 45
Registrant City: JEDDAH
Registrant State/Province:
Registrant Postal Code: -
Registrant Country: SAUDI ARABIA
Registrant Phone: +966.554654552
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: KIITECH@YAHOO.CO.UK
Registry Admin ID:
Admin Name: ABULAZEEZ AJIS
Admin Organization: INTERNET MARKETER
Admin Street: GULEIL STREET NO 45
Admin City: JEDDAH
Admin State/Province:
Admin Postal Code: -
Admin Country: SAUDI ARABIA
Admin Phone: +966.554654552
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: KIITECH@YAHOO.CO.UK
Registry Tech ID:
Tech Name: BLUEHOST INC
Tech Organization: BLUEHOST.COM
Tech Street: 1958 SOUTH 950 EAST
Tech City: PROVO
Tech State/Province: UTAH
Tech Postal Code: 84606
Tech Country: UNITED STATES
Tech Phone: +1.8017659400
Tech Phone Ext:
Tech Fax: +1.8017651992
Tech Fax Ext:
Tech Email: WHOIS@BLUEHOST.COM
Name Server: NS1.BLUEHOST.COM
Name Server: NS2.BLUEHOST.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database: 2014-05-02T17:43:17Z

The data in the BlueHost.Com WHOIS database is provided
to you by BlueHost.Com for information purposes only,
that is, to assist you in obtaining information about or related to
a domain name registration record. BlueHost.Com makes
this information available "as is," and does not guarantee its
accuracy. By submitting a WHOIS query, you agree that you will use
this data only for lawful purposes and that, under no circumstances
will you use this data to: (1) allow, enable, or otherwise support
the transmission of mass unsolicited, commercial advertising or
solicitations via direct mail, electronic mail, or by telephone; or
(2) enable high volume, automated, electronic processes that apply
to BlueHost.Com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of
BlueHost.Com. BlueHost.Com reserves the
right to modify these terms at any time. By submitting this query,
you agree to abide by these terms.

UNLIMITED storage, bandwidth and domains on one account. Also receive a *FREE* domain for one year when you host with http://www.bluehost.com/